ST6 Sialyltransferase 6/ST6GALNAC6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NB123359-Each-of-1 | In Stock | ₹ 43,387.50 |
NB123359 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 43,387.50
GST (18%): ₹ 7,809.75
Total Price: ₹ 51,197.25
Antigen
ST6 Sialyltransferase 6/ST6GALNAC6
Classification
Polyclonal
Dilution
Western Blot 1.0 ug/ml
Gene Alias
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase VI, hST6GalNAc VI, RP11-203J24.3, Sialyltransferase 7F, sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F, SIAT7F, SIAT7-F, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6, ST6GalNAc VI, ST6GalNAcVI
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ST6 Sialyltransferase 6/ST6GALNAC6 (NP_038471). Peptide sequence ALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKT
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Form
Purified
Applications
Western Blot
Conjugate
Unconjugated
Formulation
PBS buffer, 2% sucrose
Host Species
Rabbit
Purification Method
Affinity purified
Regulatory Status
RUO
Gene ID (Entrez)
30815
Content And Storage
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Related Products
Description
- ST6 Sialyltransferase 6/ST6GALNAC6 Polyclonal specifically detects ST6 Sialyltransferase 6/ST6GALNAC6 in Human samples
- It is validated for Western Blot.
Compare Similar Items
Show Difference
Antigen: ST6 Sialyltransferase 6/ST6GALNAC6
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase VI, hST6GalNAc VI, RP11-203J24.3, Sialyltransferase 7F, sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F, SIAT7F, SIAT7-F, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6, ST6GalNAc VI, ST6GalNAcVI
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ST6 Sialyltransferase 6/ST6GALNAC6 (NP_038471). Peptide sequence ALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKT
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 30815
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: GALNT5
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: EC 2.4.1.41, GALNAC-T5, MGC165041, Polypeptide GalNAc transferase 5, polypeptide N-acetylgalactosaminyltransferase 5, pp-GaNTase 5, Protein-UDP acetylgalactosaminyltransferase 5, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 5, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 5 (GalNAc-T5)
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human GALNT5 (NP_055383.1). Peptide sequence RDPKAPGQFGRPVVVPHGKEKEAERRWKEGNFNVYLSDLIPVDRAIEDTR
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 11227
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: TM7SF3
Classification: Polyclonal
Dilution: Western Blot 1.0 ug/ml
Gene Alias: seven span transmembrane protein, seven transmembrane protein TM7SF3, transmembrane 7 superfamily member 3
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TM7S3. Peptide sequence LLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWD
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Form: Purified
Applications: Western Blot
Conjugate: Unconjugated
Formulation: PBS buffer, 2% sucrose
Host Species: Rabbit
Purification Method: Affinity purified
Regulatory Status: RUO
Gene ID (Entrez): 51768
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.