Manufacturer: Thermo Scientific
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579987-Each-of-1 | In Stock | ₹ 41,963.50 |
PIPA579987 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,963.50
GST (18%): ₹ 7,553.43
Total Price: ₹ 49,516.93
SFTPA1/SFTPA2
Polyclonal
Unconjugated
Sftpa1
35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; COLEC5; collectin 5; collectin-4; Collectin-5; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; PSAP; PSPA; PSP-A; pulmonary surfactant-associated protein A; Pulmonary surfactant-associated protein A1; pulmonary surfactant-associated protein A2; Sftp1; Sftp-1; Sftpa; Sftpa1; SFTPA1B; SFTPA2; SFTPA2B; Sftpl; SP-2A; SP-2A beta; SP-2A gamma; SPA; SP-A; SPA1; SP-A1; SP-A1 beta; SP-A1 delta; SP-A1 epsilon; SP-A1 gamma; SPA2; SP-A2; SP-A2 alpha; SP-A2 delta; SPAII; surfactant associated protein A; surfactant associated protein A1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant protein A2; surfactant pulmonary associated protein A1; surfactant, pulmonary-associated protein A1; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; surfactant, pulmonary-associated protein A2A; Surfactant-associated protein 1 (pulmonary surfactant protein SP-A); Surfactant-associated protein 1 (pulmonary surfactant protein, SP-A)
Rabbit
Antigen affinity chromatography
RUO
20387, 24773, 653509, 729238
-20°C
Lyophilized
Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
500 μg/mL
PBS with 5MG BSA and 0.05MG sodium azide
P08427, P35242, Q8IWL1, Q8IWL2
Sftpa1, SFTPA2
A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN).
100 μg
Primary
Human, Mouse, Rat
Antibody
IgG